Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
Protein automated matches [190209] (5 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries) |
Domain d4cecb_: 4cec B: [229063] automated match to d4ah9a_ complexed with 2ss, act, cl, gol, so4 |
PDB Entry: 4cec (more details), 1.75 Å
SCOPe Domain Sequences for d4cecb_:
Sequence, based on SEQRES records: (download)
>d4cecb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav qmavfihnhkrkggiggysagerivdiiatdiq
>d4cecb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav qmavfihnhkrkgysagerivdiiatdiq
Timeline for d4cecb_: