Lineage for d4cefa_ (4cef A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859358Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1859480Protein automated matches [190209] (4 species)
    not a true protein
  7. 1859481Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (61 PDB entries)
  8. 1859498Domain d4cefa_: 4cef A: [229060]
    automated match to d4ah9a_
    complexed with cl, d0t, gol, so4

Details for d4cefa_

PDB Entry: 4cef (more details), 1.7 Å

PDB Description: Interrogating HIV integrase for compounds that bind- a SAMPL challenge
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4cefa_:

Sequence, based on SEQRES records: (download)

>d4cefa_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d4cefa_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq

SCOPe Domain Coordinates for d4cefa_:

Click to download the PDB-style file with coordinates for d4cefa_.
(The format of our PDB-style files is described here.)

Timeline for d4cefa_: