Lineage for d4c6aa_ (4c6a A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2558192Protein automated matches [190032] (18 species)
    not a true protein
  7. 2558398Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (3 PDB entries)
  8. 2558399Domain d4c6aa_: 4c6a A: [229058]
    automated match to d3l7ub_
    complexed with peg

Details for d4c6aa_

PDB Entry: 4c6a (more details), 1.25 Å

PDB Description: high resolution structure of the nucleoside diphosphate kinase
PDB Compounds: (A:) Nucleoside diphosphate kinase, cytosolic

SCOPe Domain Sequences for d4c6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c6aa_ d.58.6.1 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
dsvesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d4c6aa_:

Click to download the PDB-style file with coordinates for d4c6aa_.
(The format of our PDB-style files is described here.)

Timeline for d4c6aa_: