Lineage for d4c7ba_ (4c7b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107620Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2107621Protein automated matches [190312] (11 species)
    not a true protein
  7. 2107640Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)
  8. 2107659Domain d4c7ba_: 4c7b A: [229057]
    automated match to d1j8fc_
    complexed with bvb, gol, ipa, zn

Details for d4c7ba_

PDB Entry: 4c7b (more details), 2.2 Å

PDB Description: complex of human sirt3 with bromo-resveratrol and fluor-de-lys peptide
PDB Compounds: (A:) NAD-dependent protein deacetylase sirtuin-3, mitochondrial

SCOPe Domain Sequences for d4c7ba_:

Sequence, based on SEQRES records: (download)

>d4c7ba_ c.31.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaife
lpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipa
sklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqr
fllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdva
qlgdvvhgveslvellgwteemrdlvqretgk

Sequence, based on observed residues (ATOM records): (download)

>d4c7ba_ c.31.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klslqdvaeliraracqrvvvmvgagistpsgipdfrqydlpypeaifelpfffhnpkpf
ftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipasklveahgtfa
satctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqrfllhvvdfpma
dlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdvaqlgdvvhgves
lvellgwteemrdlvqretgk

SCOPe Domain Coordinates for d4c7ba_:

Click to download the PDB-style file with coordinates for d4c7ba_.
(The format of our PDB-style files is described here.)

Timeline for d4c7ba_: