Lineage for d4c7ob2 (4c7o B:91-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869314Protein automated matches [190304] (16 species)
    not a true protein
  7. 2869329Species Escherichia coli K-12 [TaxId:83333] [229053] (2 PDB entries)
  8. 2869331Domain d4c7ob2: 4c7o B:91-300 [229056]
    Other proteins in same PDB: d4c7ob1, d4c7od1, d4c7od3
    automated match to d2qy9a2
    protein/RNA complex; complexed with alf, gdp, mg

Details for d4c7ob2

PDB Entry: 4c7o (more details), 2.6 Å

PDB Description: The structural basis of FtsY recruitment and GTPase activation by SRP RNA
PDB Compounds: (B:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d4c7ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7ob2 c.37.1.10 (B:91-300) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfa

SCOPe Domain Coordinates for d4c7ob2:

Click to download the PDB-style file with coordinates for d4c7ob2.
(The format of our PDB-style files is described here.)

Timeline for d4c7ob2: