Lineage for d4c7ob1 (4c7o B:30-90)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313661Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2313717Family a.24.13.0: automated matches [229049] (1 protein)
    not a true family
  6. 2313718Protein automated matches [229050] (7 species)
    not a true protein
  7. 2313721Species Escherichia coli K-12 [TaxId:83333] [229051] (2 PDB entries)
  8. 2313723Domain d4c7ob1: 4c7o B:30-90 [229055]
    Other proteins in same PDB: d4c7ob2, d4c7od2, d4c7od3
    automated match to d2qy9a1
    protein/RNA complex; complexed with alf, gdp, mg

Details for d4c7ob1

PDB Entry: 4c7o (more details), 2.6 Å

PDB Description: The structural basis of FtsY recruitment and GTPase activation by SRP RNA
PDB Compounds: (B:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d4c7ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7ob1 a.24.13.0 (B:30-90) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dddlfeeleeqlliadvgvettrkiitnltegasrkqlrdaealygllkeemgeilakvd
e

SCOPe Domain Coordinates for d4c7ob1:

Click to download the PDB-style file with coordinates for d4c7ob1.
(The format of our PDB-style files is described here.)

Timeline for d4c7ob1: