SCOPe 2.08: Domain d4c7ob1: 4c7o B:30-90

Lineage for d4c7ob1 (4c7o B:30-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.0: automated matches [229049] (1 protein)
   not a true family

6. Protein automated matches [229050] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [229051] (2 PDB entries)

8. Domain d4c7ob1: 4c7o B:30-90 [229055]
   Other proteins in same PDB: d4c7ob2, d4c7od2, d4c7od3
   automated match to d2qy9a1
   protein/RNA complex; complexed with alf, gdp, mg

Details for d4c7ob1

PDB Entry: 4c7o, 2.6 Å

PDB Description: The structural basis of FtsY recruitment and GTPase activation by SRP RNA

PDB Compounds: (B:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d4c7ob1:

Sequence; same for both SEQRES and ATOM records:

>d4c7ob1 a.24.13.0 (B:30-90) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dddlfeeleeqlliadvgvettrkiitnltegasrkqlrdaealygllkeemgeilakvd
e

Timeline for d4c7ob1:

• d4c7ob1 first appeared in SCOPe 2.03
  
• d4c7ob1 appears in SCOPe 2.07