Lineage for d4c7od2 (4c7o D:91-302)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847600Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1847883Protein automated matches [190304] (8 species)
    not a true protein
  7. 1847889Species Escherichia coli K-12 [TaxId:83333] [229053] (2 PDB entries)
  8. 1847892Domain d4c7od2: 4c7o D:91-302 [229054]
    Other proteins in same PDB: d4c7ob1, d4c7od1
    automated match to d2qy9a2
    protein/RNA complex; complexed with alf, gdp, mg

Details for d4c7od2

PDB Entry: 4c7o (more details), 2.6 Å

PDB Description: The structural basis of FtsY recruitment and GTPase activation by SRP RNA
PDB Compounds: (D:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d4c7od2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7od2 c.37.1.10 (D:91-302) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfare

SCOPe Domain Coordinates for d4c7od2:

Click to download the PDB-style file with coordinates for d4c7od2.
(The format of our PDB-style files is described here.)

Timeline for d4c7od2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c7od1