| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein automated matches [190304] (16 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [229053] (2 PDB entries) |
| Domain d4c7od2: 4c7o D:91-302 [229054] Other proteins in same PDB: d4c7ob1, d4c7od1, d4c7od3 automated match to d2qy9a2 protein/RNA complex; complexed with alf, gdp, mg |
PDB Entry: 4c7o (more details), 2.6 Å
SCOPe Domain Sequences for d4c7od2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7od2 c.37.1.10 (D:91-302) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfare
Timeline for d4c7od2: