SCOPe 2.08: Domain d4c7od2: 4c7o D:91-302

Lineage for d4c7od2 (4c7o D:91-302)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein automated matches [190304] (16 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [229053] (2 PDB entries)

8. Domain d4c7od2: 4c7o D:91-302 [229054]
   Other proteins in same PDB: d4c7ob1, d4c7od1, d4c7od3
   automated match to d2qy9a2
   protein/RNA complex; complexed with alf, gdp, mg

Details for d4c7od2

PDB Entry: 4c7o, 2.6 Å

PDB Description: The structural basis of FtsY recruitment and GTPase activation by SRP RNA

PDB Compounds: (D:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d4c7od2:

Sequence; same for both SEQRES and ATOM records:

>d4c7od2 c.37.1.10 (D:91-302) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfare

Timeline for d4c7od2:

• d4c7od2 first appeared in SCOPe 2.03
  
• d4c7od2 appears in SCOPe 2.07