Lineage for d4bpra2 (4bpr A:142-303)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118600Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118601Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2118602Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2118690Protein automated matches [226995] (7 species)
    not a true protein
  7. 2118693Species Anabaena sp. [TaxId:1167] [229046] (3 PDB entries)
  8. 2118696Domain d4bpra2: 4bpr A:142-303 [229047]
    Other proteins in same PDB: d4bpra1
    automated match to d1ewya2
    complexed with fad, gol, so4; mutant

Details for d4bpra2

PDB Entry: 4bpr (more details), 2 Å

PDB Description: ferredoxin-nadp reductase mutant with tyr 79 replaced by phe (y79f)
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d4bpra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bpra2 c.25.1.1 (A:142-303) automated matches {Anabaena sp. [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOPe Domain Coordinates for d4bpra2:

Click to download the PDB-style file with coordinates for d4bpra2.
(The format of our PDB-style files is described here.)

Timeline for d4bpra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bpra1