Lineage for d3wjja2 (3wjj A:342-444)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356822Domain d3wjja2: 3wjj A:342-444 [229038]
    Other proteins in same PDB: d3wjjc1, d3wjjc2
    automated match to d1igtb4

Details for d3wjja2

PDB Entry: 3wjj (more details), 2.6 Å

PDB Description: Crystal structure of IIb selective Fc variant, Fc(P238D), in complex with FcgRIIb
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3wjja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wjja2 b.1.1.0 (A:342-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d3wjja2:

Click to download the PDB-style file with coordinates for d3wjja2.
(The format of our PDB-style files is described here.)

Timeline for d3wjja2: