| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein automated matches [190803] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries) |
| Domain d3wjlc2: 3wjl C:86-170 [229032] Other proteins in same PDB: d3wjla1, d3wjla2, d3wjlb1, d3wjlb2 automated match to d2fcba2 complexed with nag |
PDB Entry: 3wjl (more details), 2.86 Å
SCOPe Domain Sequences for d3wjlc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wjlc2 b.1.1.4 (C:86-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewlvlqtphlefqegetivlrchswkdkplvkvtffqngkskkfsrsdpnfsipqanhsh
sgdyhctgnigytlysskpvtitvq
Timeline for d3wjlc2:
View in 3DDomains from other chains: (mouse over for more information) d3wjla1, d3wjla2, d3wjlb1, d3wjlb2 |