Lineage for d3wjlc2 (3wjl C:86-170)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754014Domain d3wjlc2: 3wjl C:86-170 [229032]
    Other proteins in same PDB: d3wjla1, d3wjla2, d3wjlb1, d3wjlb2
    automated match to d2fcba2
    complexed with nag

Details for d3wjlc2

PDB Entry: 3wjl (more details), 2.86 Å

PDB Description: crystal structure of iib selective fc variant, fc(v12), in complex with fcgriib
PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor II-c

SCOPe Domain Sequences for d3wjlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wjlc2 b.1.1.4 (C:86-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewlvlqtphlefqegetivlrchswkdkplvkvtffqngkskkfsrsdpnfsipqanhsh
sgdyhctgnigytlysskpvtitvq

SCOPe Domain Coordinates for d3wjlc2:

Click to download the PDB-style file with coordinates for d3wjlc2.
(The format of our PDB-style files is described here.)

Timeline for d3wjlc2: