Lineage for d3w0aa_ (3w0a A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009359Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2009360Species Human (Homo sapiens) [TaxId:9606] [48529] (28 PDB entries)
  8. 2009376Domain d3w0aa_: 3w0a A: [229029]
    automated match to d3az2a_
    complexed with ds5

Details for d3w0aa_

PDB Entry: 3w0a (more details), 1.8 Å

PDB Description: crystal structure analysis of vitamin d receptor
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3w0aa_:

Sequence, based on SEQRES records: (download)

>d3w0aa_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d3w0aa_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppllyakmiqkladlrslneehskqyrclsfqpecsmk
ltplvlevfg

SCOPe Domain Coordinates for d3w0aa_:

Click to download the PDB-style file with coordinates for d3w0aa_.
(The format of our PDB-style files is described here.)

Timeline for d3w0aa_: