Lineage for d3vz7a_ (3vz7 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1352778Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1352948Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 1352949Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 1353144Protein automated matches [191245] (3 species)
    not a true protein
  7. 1353145Species Escherichia coli [TaxId:562] [229023] (2 PDB entries)
  8. 1353146Domain d3vz7a_: 3vz7 A: [229027]
    automated match to d1la1a_

Details for d3vz7a_

PDB Entry: 3vz7 (more details), 1.8 Å

PDB Description: Crystal Structure Analysis of the mini-chaperonin variant with Pro 187 Gly
PDB Compounds: (A:) 60 kda chaperonin

SCOPe Domain Sequences for d3vz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vz7a_ c.8.5.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
glvgrgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

SCOPe Domain Coordinates for d3vz7a_:

Click to download the PDB-style file with coordinates for d3vz7a_.
(The format of our PDB-style files is described here.)

Timeline for d3vz7a_: