SCOPe 2.08: Domain d3vyhb_: 3vyh B:

Lineage for d3vyhb_ (3vyh B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension
   automatically mapped to Pfam PF02211

6. Protein automated matches [190606] (3 species)
   not a true protein

7. Species Pseudonocardia thermophila [TaxId:1848] [229020] (5 PDB entries)

8. Domain d3vyhb_: 3vyh B: [229021]
   Other proteins in same PDB: d3vyha_
   automated match to d1ireb_
   complexed with co; mutant

Details for d3vyhb_

PDB Entry: 3vyh, 1.63 Å

PDB Description: Crystal structure of aW116R mutant of nitrile hydratase from Pseudonocardia thermophilla

PDB Compounds: (B:) Cobalt-containing nitrile hydratase subunit beta

SCOPe Domain Sequences for d3vyhb_:

Sequence; same for both SEQRES and ATOM records:

>d3vyhb_ b.34.4.4 (B:) automated matches {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielv

Timeline for d3vyhb_:

• d3vyhb_ first appeared in SCOPe 2.03
  
• d3vyhb_ appears in SCOPe 2.07