Lineage for d2azab_ (2aza B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries) 
Domain d2azab_: 2aza B: [22902]
Details for d2azab_
PDB Entry: 2aza (more details), 1.8 Å
PDB Description: structure of azurin from alcaligenes denitrificans. refinement at 1.8 angstroms resolution and comparison of the two crystallographically independent molecules
SCOP Domain Sequences for d2azab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azab_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn
SCOP Domain Coordinates for d2azab_:
Click to download the PDB-style file with coordinates for d2azab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2azab_:
- d2azab_ appears in SCOP 1.57
- d2azab_ appears in the current release, SCOPe 2.08
View in 3D
