Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins) N-terminal all-beta domain defines family |
Protein Alcohol dehydrogenase [51737] (9 species) |
Species Horse (Equus caballus) [TaxId:9796] [51738] (46 PDB entries) Uniprot P00327 |
Domain d4ng5a2: 4ng5 A:164-339 [229014] Other proteins in same PDB: d4ng5a1, d4ng5b1 automated match to d1axga2 complexed with mrd, naj, pfb, zn |
PDB Entry: 4ng5 (more details), 1.1 Å
SCOPe Domain Sequences for d4ng5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ng5a2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} splekvcligcgfstgygsavkvakvtqgstcavfglggaglsvimgckaagaariigvd inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk
Timeline for d4ng5a2: