Lineage for d2azaa_ (2aza A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162482Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 162500Protein Azurin [49530] (6 species)
  7. 162501Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 162504Domain d2azaa_: 2aza A: [22901]

Details for d2azaa_

PDB Entry: 2aza (more details), 1.8 Å

PDB Description: structure of azurin from alcaligenes denitrificans. refinement at 1.8 angstroms resolution and comparison of the two crystallographically independent molecules

SCOP Domain Sequences for d2azaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azaa_ b.6.1.1 (A:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn

SCOP Domain Coordinates for d2azaa_:

Click to download the PDB-style file with coordinates for d2azaa_.
(The format of our PDB-style files is described here.)

Timeline for d2azaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2azab_