Lineage for d4nfsb1 (4nfs B:1-163,B:340-374)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1311670Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1311671Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1311792Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1311810Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 1311827Species Horse (Equus caballus) [TaxId:9796] [50138] (40 PDB entries)
    Uniprot P00327
  8. 1311845Domain d4nfsb1: 4nfs B:1-163,B:340-374 [229008]
    Other proteins in same PDB: d4nfsa2, d4nfsb2
    automated match to d1axga1
    complexed with etf, mrd, naj, zn

Details for d4nfsb1

PDB Entry: 4nfs (more details), 1.1 Å

PDB Description: v203a horse liver alcohol dehydrogenase e complexed with nad and 2,2, 2-trifluoroethanol
PDB Compounds: (B:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d4nfsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfsb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d4nfsb1:

Click to download the PDB-style file with coordinates for d4nfsb1.
(The format of our PDB-style files is described here.)

Timeline for d4nfsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nfsb2