Lineage for d4nasd2 (4nas D:123-407)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1574721Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1575019Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 1575020Protein automated matches [227123] (6 species)
    not a true protein
  7. 1575021Species Alicyclobacillus acidocaldarius [TaxId:521098] [229001] (1 PDB entry)
  8. 1575025Domain d4nasd2: 4nas D:123-407 [229004]
    Other proteins in same PDB: d4nasa1, d4nasb1, d4nasc1, d4nasd1
    automated match to d3a12a2
    complexed with ca, cl, fmt, gol

Details for d4nasd2

PDB Entry: 4nas (more details), 1.92 Å

PDB Description: The crystal structure of a rubisco-like protein (MtnW) from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
PDB Compounds: (D:) Ribulose-bisphosphate carboxylase

SCOPe Domain Sequences for d4nasd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nasd2 c.1.14.0 (D:123-407) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
pgpkfgvegvrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddeifft
eayatpedrvrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagallvnv
vaygydvvadlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadigifp
smygsvtlgreatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlnaggg
ihghpggarmggraffdaiwavehgvpleeaakdrpalrqalekw

SCOPe Domain Coordinates for d4nasd2:

Click to download the PDB-style file with coordinates for d4nasd2.
(The format of our PDB-style files is described here.)

Timeline for d4nasd2: