Lineage for d4nasa2 (4nas A:123-408)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100959Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2100960Protein automated matches [227123] (7 species)
    not a true protein
  7. 2100961Species Alicyclobacillus acidocaldarius [TaxId:521098] [229001] (1 PDB entry)
  8. 2100962Domain d4nasa2: 4nas A:123-408 [229003]
    Other proteins in same PDB: d4nasa1, d4nasb1, d4nasc1, d4nasd1
    automated match to d3a12a2
    complexed with ca, cl, fmt, gol

Details for d4nasa2

PDB Entry: 4nas (more details), 1.92 Å

PDB Description: The crystal structure of a rubisco-like protein (MtnW) from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
PDB Compounds: (A:) Ribulose-bisphosphate carboxylase

SCOPe Domain Sequences for d4nasa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nasa2 c.1.14.0 (A:123-408) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
pgpkfgvegvrrrlgaynrplvmsifkacagltldelveafgeqaeggvdlvkddeifft
eayatpedrvrayaakadeiaqrtgrrtayavnltgpvhslrerarrlaelgagallvnv
vaygydvvadlardpdvdvpilahpavsgalygspnygiaadivlgqlmrlagadigifp
smygsvtlgreatdrllqhlraegphkpvlpapsagiypglvprlyqdfgvdlvlnaggg
ihghpggarmggraffdaiwavehgvpleeaakdrpalrqalekwg

SCOPe Domain Coordinates for d4nasa2:

Click to download the PDB-style file with coordinates for d4nasa2.
(The format of our PDB-style files is described here.)

Timeline for d4nasa2: