Lineage for d4mf0a_ (4mf0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589523Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2589524Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2589569Domain d4mf0a_: 4mf0 A: [228993]
    automated match to d4kioa_
    complexed with 29z

Details for d4mf0a_

PDB Entry: 4mf0 (more details), 2.67 Å

PDB Description: itk kinase domain in complex with benzothiazole inhibitor compound 12a (1s,2s)-2-{4-[(dimethylamino)methyl]phenyl}-n-[6-(pyridin-3-yl)-1,3-benzothiazol-2-yl]cyclopropanecarboxamide (12a)
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4mf0a_:

Sequence, based on SEQRES records: (download)

>d4mf0a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records): (download)

>d4mf0a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsglvhlgywlnkdkvaiktimseedfieeaevmmklshpklvqlyg
vcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvihrdl
aarnclvgenqvikvsdfgmtpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipy
enrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiaesg

SCOPe Domain Coordinates for d4mf0a_:

Click to download the PDB-style file with coordinates for d4mf0a_.
(The format of our PDB-style files is described here.)

Timeline for d4mf0a_: