Lineage for d4n69b_ (4n69 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079733Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079734Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2080029Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2080030Protein automated matches [190967] (30 species)
    not a true protein
  7. 2080188Species Soybean (Glycine max) [TaxId:3847] [228990] (3 PDB entries)
  8. 2080192Domain d4n69b_: 4n69 B: [228992]
    automated match to d3gvdc_
    complexed with po4, ser

Details for d4n69b_

PDB Entry: 4n69 (more details), 1.8 Å

PDB Description: Soybean Serine Acetyltransferase Complexed with Serine
PDB Compounds: (B:) Serine Acetyltransferase Apoenzyme

SCOPe Domain Sequences for d4n69b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n69b_ b.81.1.0 (B:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
apdeegwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllst
llydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllw
rqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvt
lggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnpa
rlv

SCOPe Domain Coordinates for d4n69b_:

Click to download the PDB-style file with coordinates for d4n69b_.
(The format of our PDB-style files is described here.)

Timeline for d4n69b_: