Class b: All beta proteins [48724] (176 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (28 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [228990] (3 PDB entries) |
Domain d4n69b_: 4n69 B: [228992] automated match to d3gvdc_ complexed with po4, ser |
PDB Entry: 4n69 (more details), 1.8 Å
SCOPe Domain Sequences for d4n69b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n69b_ b.81.1.0 (B:) automated matches {Soybean (Glycine max) [TaxId: 3847]} apdeegwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllst llydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllw rqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvt lggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnpa rlv
Timeline for d4n69b_: