Lineage for d4mlwa_ (4mlw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711100Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 2711101Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)
  8. 2711102Domain d4mlwa_: 4mlw A: [228987]
    automated match to d1omra_
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d4mlwa_

PDB Entry: 4mlw (more details), 1.45 Å

PDB Description: Crystal structure of non-myristoylated recoverin at 1.45 A resolution with calcium bound to EF-hand 3
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d4mlwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlwa_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkaya
qhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleiv
taifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrli
qfepqkvkeklk

SCOPe Domain Coordinates for d4mlwa_:

Click to download the PDB-style file with coordinates for d4mlwa_.
(The format of our PDB-style files is described here.)

Timeline for d4mlwa_: