| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Burkholderia thailandensis [TaxId:271848] [228981] (1 PDB entry) |
| Domain d4m9aa2: 4m9a A:229-377 [228984] Other proteins in same PDB: d4m9aa1, d4m9ab1, d4m9ac1, d4m9ad1 automated match to d1ukwa1 complexed with fda |
PDB Entry: 4m9a (more details), 2.2 Å
SCOPe Domain Sequences for d4m9aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m9aa2 a.29.3.0 (A:229-377) automated matches {Burkholderia thailandensis [TaxId: 271848]}
geglkialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanm
atqinaarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdye
verhyrdaritqiyegtsevqrmviarql
Timeline for d4m9aa2: