Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (18 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [228981] (1 PDB entry) |
Domain d4m9ad2: 4m9a D:229-377 [228982] Other proteins in same PDB: d4m9aa1, d4m9ab1, d4m9ac1, d4m9ad1 automated match to d1ukwa1 complexed with fda |
PDB Entry: 4m9a (more details), 2.2 Å
SCOPe Domain Sequences for d4m9ad2:
Sequence, based on SEQRES records: (download)
>d4m9ad2 a.29.3.0 (D:229-377) automated matches {Burkholderia thailandensis [TaxId: 271848]} geglkialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanm atqinaarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdye verhyrdaritqiyegtsevqrmviarql
>d4m9ad2 a.29.3.0 (D:229-377) automated matches {Burkholderia thailandensis [TaxId: 271848]} geglkialsnleggrigiaaqatgiaraafdrarryarerkpiaehqaiaeklanmatqi naarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverh yrdaritqiyegtsevqrmviarql
Timeline for d4m9ad2: