Lineage for d4m9ad2 (4m9a D:229-377)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488075Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1488205Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1488206Protein automated matches [226935] (18 species)
    not a true protein
  7. 1488251Species Burkholderia thailandensis [TaxId:271848] [228981] (1 PDB entry)
  8. 1488255Domain d4m9ad2: 4m9a D:229-377 [228982]
    Other proteins in same PDB: d4m9aa1, d4m9ab1, d4m9ac1, d4m9ad1
    automated match to d1ukwa1
    complexed with fda

Details for d4m9ad2

PDB Entry: 4m9a (more details), 2.2 Å

PDB Description: Crystal structure of Acyl-coA dehydrogenase from Burkholderia thailandensis E264
PDB Compounds: (D:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4m9ad2:

Sequence, based on SEQRES records: (download)

>d4m9ad2 a.29.3.0 (D:229-377) automated matches {Burkholderia thailandensis [TaxId: 271848]}
geglkialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanm
atqinaarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdye
verhyrdaritqiyegtsevqrmviarql

Sequence, based on observed residues (ATOM records): (download)

>d4m9ad2 a.29.3.0 (D:229-377) automated matches {Burkholderia thailandensis [TaxId: 271848]}
geglkialsnleggrigiaaqatgiaraafdrarryarerkpiaehqaiaeklanmatqi
naarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdyeverh
yrdaritqiyegtsevqrmviarql

SCOPe Domain Coordinates for d4m9ad2:

Click to download the PDB-style file with coordinates for d4m9ad2.
(The format of our PDB-style files is described here.)

Timeline for d4m9ad2: