Lineage for d4m2oa_ (4m2o A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324265Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 2324266Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)
  8. 2324270Domain d4m2oa_: 4m2o A: [228971]
    automated match to d1omra_
    complexed with ca; mutant

Details for d4m2oa_

PDB Entry: 4m2o (more details), 1.5 Å

PDB Description: Crystal structure of a non-myristoylated C39A recoverin mutant with one calcium ion bound to EF-hand 3
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d4m2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m2oa_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkeapsgritrqefqtiyskffpeadpkaya
qhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleiv
taifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrli
qfepqkvkekl

SCOPe Domain Coordinates for d4m2oa_:

Click to download the PDB-style file with coordinates for d4m2oa_.
(The format of our PDB-style files is described here.)

Timeline for d4m2oa_: