Lineage for d1f56b_ (1f56 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770821Protein Plantacyanin [49527] (2 species)
    basic blue protein
  7. 2770824Species Spinach (Spinacia oleracea) [TaxId:3562] [49529] (1 PDB entry)
  8. 2770826Domain d1f56b_: 1f56 B: [22897]
    complexed with cu1, so4

Details for d1f56b_

PDB Entry: 1f56 (more details), 2.05 Å

PDB Description: spinach plantacyanin
PDB Compounds: (B:) plantacyanin

SCOPe Domain Sequences for d1f56b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f56b_ b.6.1.1 (B:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]}
avynigwsfnvngargksfragdvlvfkyikgqhnvvavngrgyascsaprgartyssgq
drikltrgqnyficsfpghcgggmkiainak

SCOPe Domain Coordinates for d1f56b_:

Click to download the PDB-style file with coordinates for d1f56b_.
(The format of our PDB-style files is described here.)

Timeline for d1f56b_: