![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plantacyanin [49527] (2 species) basic blue protein |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [49529] (1 PDB entry) |
![]() | Domain d1f56b_: 1f56 B: [22897] complexed with cu1, so4 |
PDB Entry: 1f56 (more details), 2.05 Å
SCOPe Domain Sequences for d1f56b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f56b_ b.6.1.1 (B:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} avynigwsfnvngargksfragdvlvfkyikgqhnvvavngrgyascsaprgartyssgq drikltrgqnyficsfpghcgggmkiainak
Timeline for d1f56b_: