Lineage for d4lp0a_ (4lp0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974212Species Streptococcus pneumoniae [TaxId:760835] [226426] (7 PDB entries)
  8. 2974216Domain d4lp0a_: 4lp0 A: [228969]
    automated match to d4em7a_
    complexed with 1ym

Details for d4lp0a_

PDB Entry: 4lp0 (more details), 1.95 Å

PDB Description: Crystal structure of a topoisomerase ATP inhibitor
PDB Compounds: (A:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d4lp0a_:

Sequence, based on SEQRES records: (download)

>d4lp0a_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760835]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhaggkfgqggyktsgglhgvgssvvnalsswlev
eitrdgavykqrfenggkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiser
lnesafllknvtlsltdkrtdeaiefhyen

Sequence, based on observed residues (ATOM records): (download)

>d4lp0a_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760835]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhvgssvvnalsswleveitrdgavykqrfenggk
pvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserlnesafllknvtlsltdk
rtdeaiefhyen

SCOPe Domain Coordinates for d4lp0a_:

Click to download the PDB-style file with coordinates for d4lp0a_.
(The format of our PDB-style files is described here.)

Timeline for d4lp0a_: