SCOPe 2.08: Domain d4lf3d2: 4lf3 D:107-214

Lineage for d4lf3d2 (4lf3 D:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4lf3d2: 4lf3 D:107-214 [228968]
   Other proteins in same PDB: d4lf3a1, d4lf3b_, d4lf3d1, d4lf3e_
   automated match to d4ersl2

Details for d4lf3d2

PDB Entry: 4lf3, 2.73 Å

PDB Description: Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor

PDB Compounds: (D:) Fab heavy chain

SCOPe Domain Sequences for d4lf3d2:

Sequence; same for both SEQRES and ATOM records:

>d4lf3d2 b.1.1.2 (D:107-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4lf3d2:

• d4lf3d2 first appeared in SCOPe 2.03
  
• d4lf3d2 appears in SCOPe 2.07