SCOPe 2.04: Domain d4lf3a2: 4lf3 A:107-214

Lineage for d4lf3a2 (4lf3 A:107-214)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d4lf3a2: 4lf3 A:107-214 [228967]
   Other proteins in same PDB: d4lf3a1, d4lf3d1
   automated match to d4ersl2

Details for d4lf3a2

PDB Entry: 4lf3, 2.73 Å

PDB Description: Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor

PDB Compounds: (A:) Fab heavy chain

SCOPe Domain Sequences for d4lf3a2:

Sequence; same for both SEQRES and ATOM records:

>d4lf3a2 b.1.1.2 (A:107-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4lf3a2:

• d4lf3a2 first appeared in SCOPe 2.03
  
• d4lf3a2 appears in SCOPe 2.05
  
• d4lf3a2 appears in the current release, SCOPe 2.08