SCOPe 2.05: Domain d4lf3a1: 4lf3 A:1-106

Lineage for d4lf3a1 (4lf3 A:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4lf3a1: 4lf3 A:1-106 [228965]
   Other proteins in same PDB: d4lf3a2, d4lf3d2
   automated match to d4ersl1

Details for d4lf3a1

PDB Entry: 4lf3, 2.73 Å

PDB Description: Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor

PDB Compounds: (A:) Fab heavy chain

SCOPe Domain Sequences for d4lf3a1:

Sequence; same for both SEQRES and ATOM records:

>d4lf3a1 b.1.1.0 (A:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkvei

Timeline for d4lf3a1:

• d4lf3a1 first appeared in SCOPe 2.03
  
• d4lf3a1 appears in SCOPe 2.04
  
• d4lf3a1 appears in SCOPe 2.06
  
• d4lf3a1 appears in the current release, SCOPe 2.08