Lineage for d4kopa_ (4kop A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897114Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 1897115Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 1897173Family d.18.1.0: automated matches [191638] (1 protein)
    not a true family
  6. 1897174Protein automated matches [191174] (3 species)
    not a true protein
  7. 1897186Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [228960] (1 PDB entry)
  8. 1897187Domain d4kopa_: 4kop A: [228962]
    automated match to d3n1ha_
    complexed with mpo

Details for d4kopa_

PDB Entry: 4kop (more details), 1.75 Å

PDB Description: crystal structure of why2 from arabidopsis thaliana
PDB Compounds: (A:) Single-stranded DNA-binding protein WHY2, mitochondrial

SCOPe Domain Sequences for d4kopa_:

Sequence, based on SEQRES records: (download)

>d4kopa_ d.18.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpsmkssnagqvrkslsvkphadgsgyfislsvnns
ilktndyfvvpvtkaefavmktafsfalphimgwnrltghle

Sequence, based on observed residues (ATOM records): (download)

>d4kopa_ d.18.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rlfapysifkgkaalsvepvlpsfteidsgnlridrrgslmmtfmpaigerkydwekkqk
falsptevgslismgskdsseffhdpqvrkslsvkphadgsgyfislsvnnsilktndyf
vvpvtkaefavmktafsfalphimgwnrltghle

SCOPe Domain Coordinates for d4kopa_:

Click to download the PDB-style file with coordinates for d4kopa_.
(The format of our PDB-style files is described here.)

Timeline for d4kopa_: