| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily) helix-swapped dimer of beta(4)-alpha motifs |
Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) ![]() |
| Family d.18.1.2: Plant transcriptional regulator PBF-2 [75375] (2 proteins) single-chain domain formed by a tandem repeat of two motifs |
| Protein automated matches [228955] (1 species) not a true protein |
| Species Arabidopsis thaliana [TaxId:3702] [228956] (2 PDB entries) |
| Domain d4kood_: 4koo D: [228959] automated match to d1l3aa_ complexed with mes, ni, po4 |
PDB Entry: 4koo (more details), 1.88 Å
SCOPe Domain Sequences for d4kood_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kood_ d.18.1.2 (D:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
lparfyvghsiykgkaaltvdprapefvaldsgafklskdgflllqfapsagvrqydwsk
kqvfslsvteigtlvslgpresceffhdpfkgksdegkvrkvlkveplpdgsghffnlsv
qnklvnvdesiyipitraefavlisafnfvlpyligwhafansikaaalehhhhh
Timeline for d4kood_: