Lineage for d4kood_ (4koo D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405910Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 1405911Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 1405927Family d.18.1.2: Plant transcriptional regulator PBF-2 [75375] (2 proteins)
    single-chain domain formed by a tandem repeat of two motifs
  6. 1405934Protein automated matches [228955] (1 species)
    not a true protein
  7. 1405935Species Arabidopsis thaliana [TaxId:3702] [228956] (2 PDB entries)
  8. 1405939Domain d4kood_: 4koo D: [228959]
    automated match to d1l3aa_
    complexed with mes, ni, po4

Details for d4kood_

PDB Entry: 4koo (more details), 1.88 Å

PDB Description: crystal structure of why1 from arabidopsis thaliana
PDB Compounds: (D:) Single-stranded DNA-binding protein WHY1, chloroplastic

SCOPe Domain Sequences for d4kood_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kood_ d.18.1.2 (D:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
lparfyvghsiykgkaaltvdprapefvaldsgafklskdgflllqfapsagvrqydwsk
kqvfslsvteigtlvslgpresceffhdpfkgksdegkvrkvlkveplpdgsghffnlsv
qnklvnvdesiyipitraefavlisafnfvlpyligwhafansikaaalehhhhh

SCOPe Domain Coordinates for d4kood_:

Click to download the PDB-style file with coordinates for d4kood_.
(The format of our PDB-style files is described here.)

Timeline for d4kood_: