SCOPe 2.08: Domain d4koqa1: 4koq A:82-245

Lineage for d4koqa1 (4koq A:82-245)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.2: Plant transcriptional regulator PBF-2 [75375] (2 proteins)
   single-chain domain formed by a tandem repeat of two motifs

6. Protein automated matches [228955] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [228956] (2 PDB entries)

8. Domain d4koqa1: 4koq A:82-245 [228957]
   Other proteins in same PDB: d4koqa2
   automated match to d1l3aa_
   complexed with po4

Details for d4koqa1

PDB Entry: 4koq, 1.85 Å

PDB Description: crystal structure of why3 from arabidopsis thaliana

PDB Compounds: (A:) Single-stranded DNA-binding protein WHY3, chloroplastic

SCOPe Domain Sequences for d4koqa1:

Sequence; same for both SEQRES and ATOM records:

>d4koqa1 d.18.1.2 (A:82-245) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sprfyvghsiykgkaaltieprapefvalesgafkltkegflllqfapaagvrqydwsrk
qvfslsvteignlvslgpresceffhdpfkgkgdegkvrkvlkveplpdgsgrffnlsvq
nkllnvdesvyipitkaefavlisafnfvlphligwsafansik

Timeline for d4koqa1:

• d4koqa1 first appeared in SCOPe 2.03, called d4koqa_
  
• d4koqa1 appears in SCOPe 2.07