Lineage for d4k5ca_ (4k5c A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685836Species Escherichia coli [TaxId:562] [189927] (3 PDB entries)
  8. 1685837Domain d4k5ca_: 4k5c A: [228954]
    automated match to d4duia_

Details for d4k5ca_

PDB Entry: 4k5c (more details), 1.7 Å

PDB Description: From DARPins to LoopDARPins: Novel LoopDARPin Design Allows the Selection of Low Picomolar Binders in a Single Round of Ribosome Display
PDB Compounds: (A:) Loop Designed Ankyrin Repeat Protein Nran1_G06_C

SCOPe Domain Sequences for d4k5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k5ca_ d.211.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
dlgkklleaawqgqddevrilmangadvnaqdkfgttplhlaadmghleivevllktgad
vnaaatghyfqpyfshsvsyfgetplhlaaemghleivevllkagadvnafadlghtplh
laaqwghleivevllkhgadvnaqdkfgktpfdlaidngnediaevlqka

SCOPe Domain Coordinates for d4k5ca_:

Click to download the PDB-style file with coordinates for d4k5ca_.
(The format of our PDB-style files is described here.)

Timeline for d4k5ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4k5cb_