SCOPe 2.03: Domain d4k5ca_: 4k5c A:

Lineage for d4k5ca_ (4k5c A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189927] (3 PDB entries)

8. Domain d4k5ca_: 4k5c A: [228954]
   automated match to d4duia_

Details for d4k5ca_

PDB Entry: 4k5c, 1.7 Å

PDB Description: From DARPins to LoopDARPins: Novel LoopDARPin Design Allows the Selection of Low Picomolar Binders in a Single Round of Ribosome Display

PDB Compounds: (A:) Loop Designed Ankyrin Repeat Protein Nran1_G06_C

SCOPe Domain Sequences for d4k5ca_:

Sequence; same for both SEQRES and ATOM records:

>d4k5ca_ d.211.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
dlgkklleaawqgqddevrilmangadvnaqdkfgttplhlaadmghleivevllktgad
vnaaatghyfqpyfshsvsyfgetplhlaaemghleivevllkagadvnafadlghtplh
laaqwghleivevllkhgadvnaqdkfgktpfdlaidngnediaevlqka

Timeline for d4k5ca_:

• d4k5ca_ is new in SCOPe 2.03-stable
  
• d4k5ca_ appears in SCOPe 2.04
  
• d4k5ca_ appears in the current release, SCOPe 2.08