Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [189927] (3 PDB entries) |
Domain d4k5ca_: 4k5c A: [228954] automated match to d4duia_ |
PDB Entry: 4k5c (more details), 1.7 Å
SCOPe Domain Sequences for d4k5ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k5ca_ d.211.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} dlgkklleaawqgqddevrilmangadvnaqdkfgttplhlaadmghleivevllktgad vnaaatghyfqpyfshsvsyfgetplhlaaemghleivevllkagadvnafadlghtplh laaqwghleivevllkhgadvnaqdkfgktpfdlaidngnediaevlqka
Timeline for d4k5ca_: