Lineage for d4k06a_ (4k06 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346108Species Bothrops brazili [TaxId:157546] [228951] (1 PDB entry)
  8. 2346109Domain d4k06a_: 4k06 A: [228953]
    automated match to d3cxia_
    complexed with 7pe, pe4, pge, so4

Details for d4k06a_

PDB Entry: 4k06 (more details), 2.08 Å

PDB Description: Crystal structure of MTX-II from Bothrops brazili venom complexed with polyethylene glycol
PDB Compounds: (A:) mtx-II

SCOPe Domain Sequences for d4k06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k06a_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops brazili [TaxId: 157546]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOPe Domain Coordinates for d4k06a_:

Click to download the PDB-style file with coordinates for d4k06a_.
(The format of our PDB-style files is described here.)

Timeline for d4k06a_: