SCOPe 2.07: Domain d2cbpa_: 2cbp A:

Lineage for d2cbpa_ (2cbp A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plantacyanin [49527] (2 species)
   basic blue protein

7. Species Cucumber (Cucumis sativus) [TaxId:3659] [49528] (1 PDB entry)

8. Domain d2cbpa_: 2cbp A: [22895]
   complexed with cu

Details for d2cbpa_

PDB Entry: 2cbp, 1.8 Å

PDB Description: cucumber basic protein, a blue copper protein

PDB Compounds: (A:) cucumber basic protein

SCOPe Domain Sequences for d2cbpa_:

Sequence; same for both SEQRES and ATOM records:

>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]}
avyvvggsggwtfnteswpkgkrfragdillfnynpsmhnvvvvnqggfstcntpagakv
ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal

Timeline for d2cbpa_:

• d2cbpa_ first appeared (with stable ids) in SCOP 1.55, called d2cbp__
  
• d2cbpa_ appears in SCOPe 2.06
  
• d2cbpa_ appears in the current release, SCOPe 2.08