Lineage for d2cbp__ (2cbp -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11041Protein Plantacyanin [49527] (2 species)
  7. 11042Species Cucumber (Cucumis sativus) [TaxId:3659] [49528] (1 PDB entry)
  8. 11043Domain d2cbp__: 2cbp - [22895]

Details for d2cbp__

PDB Entry: 2cbp (more details), 1.8 Å

PDB Description: cucumber basic protein, a blue copper protein

SCOP Domain Sequences for d2cbp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbp__ b.6.1.1 (-) Plantacyanin {Cucumber (Cucumis sativus)}
avyvvggsggwtfnteswpkgkrfragdillfnynpsmhnvvvvnqggfstcntpagakv
ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal

SCOP Domain Coordinates for d2cbp__:

Click to download the PDB-style file with coordinates for d2cbp__.
(The format of our PDB-style files is described here.)

Timeline for d2cbp__: