Lineage for d2cbpa_ (2cbp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770821Protein Plantacyanin [49527] (2 species)
    basic blue protein
  7. 2770822Species Cucumber (Cucumis sativus) [TaxId:3659] [49528] (1 PDB entry)
  8. 2770823Domain d2cbpa_: 2cbp A: [22895]
    complexed with cu

Details for d2cbpa_

PDB Entry: 2cbp (more details), 1.8 Å

PDB Description: cucumber basic protein, a blue copper protein
PDB Compounds: (A:) cucumber basic protein

SCOPe Domain Sequences for d2cbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]}
avyvvggsggwtfnteswpkgkrfragdillfnynpsmhnvvvvnqggfstcntpagakv
ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal

SCOPe Domain Coordinates for d2cbpa_:

Click to download the PDB-style file with coordinates for d2cbpa_.
(The format of our PDB-style files is described here.)

Timeline for d2cbpa_: