![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plantacyanin [49527] (2 species) basic blue protein |
![]() | Species Cucumber (Cucumis sativus) [TaxId:3659] [49528] (1 PDB entry) |
![]() | Domain d2cbpa_: 2cbp A: [22895] complexed with cu |
PDB Entry: 2cbp (more details), 1.8 Å
SCOPe Domain Sequences for d2cbpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} avyvvggsggwtfnteswpkgkrfragdillfnynpsmhnvvvvnqggfstcntpagakv ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal
Timeline for d2cbpa_: