Lineage for d4i88h_ (4i88 H:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304767Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304768Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1304769Family b.15.1.1: HSP20 [49765] (1 protein)
  6. 1304770Protein Small heat shock protein [49766] (2 species)
  7. 1304771Species Methanococcus jannaschii [TaxId:2190] [49767] (2 PDB entries)
  8. 1304779Domain d4i88h_: 4i88 H: [228941]
    automated match to d1shsa_

Details for d4i88h_

PDB Entry: 4i88 (more details), 2.85 Å

PDB Description: R107G HSP16.5
PDB Compounds: (H:) Small heat shock protein HSP16.5

SCOPe Domain Sequences for d4i88h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i88h_ b.15.1.1 (H:) Small heat shock protein {Methanococcus jannaschii [TaxId: 2190]}
giqisgkgfmpisiiegdqhikviawlpgvnkediilnavgdtleirakrsplmiteser
iiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaessikkginie

SCOPe Domain Coordinates for d4i88h_:

Click to download the PDB-style file with coordinates for d4i88h_.
(The format of our PDB-style files is described here.)

Timeline for d4i88h_: