Lineage for d1adwb_ (1adw B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106854Protein Pseudoazurin [49522] (4 species)
  7. 106873Species Thiosphaera pantotropha [TaxId:82367] [49526] (1 PDB entry)
  8. 106875Domain d1adwb_: 1adw B: [22894]

Details for d1adwb_

PDB Entry: 1adw (more details), 2.5 Å

PDB Description: pseudoazurin

SCOP Domain Sequences for d1adwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adwb_ b.6.1.1 (B:) Pseudoazurin {Thiosphaera pantotropha}
athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
qvn

SCOP Domain Coordinates for d1adwb_:

Click to download the PDB-style file with coordinates for d1adwb_.
(The format of our PDB-style files is described here.)

Timeline for d1adwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1adwa_