SCOPe 2.07: Domain d4i88e_: 4i88 E:

Lineage for d4i88e_ (4i88 E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.1: HSP20 [49765] (2 proteins)

6. Protein Small heat shock protein [49766] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [49767] (3 PDB entries)

8. Domain d4i88e_: 4i88 E: [228935]
   automated match to d1shsa_

Details for d4i88e_

PDB Entry: 4i88, 2.85 Å

PDB Description: R107G HSP16.5

PDB Compounds: (E:) Small heat shock protein HSP16.5

SCOPe Domain Sequences for d4i88e_:

Sequence; same for both SEQRES and ATOM records:

>d4i88e_ b.15.1.1 (E:) Small heat shock protein {Methanococcus jannaschii [TaxId: 2190]}
giqisgkgfmpisiiegdqhikviawlpgvnkediilnavgdtleirakrsplmiteser
iiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaessikkginie

Timeline for d4i88e_:

• d4i88e_ first appeared in SCOPe 2.03
  
• d4i88e_ appears in SCOPe 2.06
  
• d4i88e_ appears in the current release, SCOPe 2.08