Lineage for d4i6ra_ (4i6r A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322951Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2322952Protein automated matches [190907] (17 species)
    not a true protein
  7. 2322961Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)
  8. 2322962Domain d4i6ra_: 4i6r A: [228933]
    automated match to d3s8qb_
    complexed with gol, so4

Details for d4i6ra_

PDB Entry: 4i6r (more details), 1.38 Å

PDB Description: High Resolution Crystal Structure of the Wild-Type Restriction-Modification Controller Protein C.Esp1396I (Triclinic form)
PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d4i6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6ra_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkglev
sdvvffemlikeilkhd

SCOPe Domain Coordinates for d4i6ra_:

Click to download the PDB-style file with coordinates for d4i6ra_.
(The format of our PDB-style files is described here.)

Timeline for d4i6ra_: