SCOPe 2.08: Domain d4i6ra_: 4i6r A:

Lineage for d4i6ra_ (4i6r A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (21 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4i6ra_: 4i6r A: [228933]
   automated match to d3s8qb_
   complexed with gol, so4

Details for d4i6ra_

PDB Entry: 4i6r, 1.38 Å

PDB Description: High Resolution Crystal Structure of the Wild-Type Restriction-Modification Controller Protein C.Esp1396I (Triclinic form)

PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d4i6ra_:

Sequence; same for both SEQRES and ATOM records:

>d4i6ra_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkglev
sdvvffemlikeilkhd

Timeline for d4i6ra_:

• d4i6ra_ first appeared in SCOPe 2.03
  
• d4i6ra_ appears in SCOPe 2.07