Lineage for d4i6rb_ (4i6r B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268494Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1268495Protein automated matches [190907] (3 species)
    not a true protein
  7. 1268496Species Enterobacter sp. [TaxId:211595] [189872] (11 PDB entries)
  8. 1268504Domain d4i6rb_: 4i6r B: [228932]
    automated match to d3s8qb_
    complexed with gol, so4

Details for d4i6rb_

PDB Entry: 4i6r (more details), 1.38 Å

PDB Description: High Resolution Crystal Structure of the Wild-Type Restriction-Modification Controller Protein C.Esp1396I (Triclinic form)
PDB Compounds: (B:) Regulatory protein

SCOPe Domain Sequences for d4i6rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6rb_ a.35.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkglev
sdvvffemlikeilkhd

SCOPe Domain Coordinates for d4i6rb_:

Click to download the PDB-style file with coordinates for d4i6rb_.
(The format of our PDB-style files is described here.)

Timeline for d4i6rb_: