| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
| Protein automated matches [190907] (3 species) not a true protein |
| Species Enterobacter sp. [TaxId:211595] [189872] (11 PDB entries) |
| Domain d4i6rb_: 4i6r B: [228932] automated match to d3s8qb_ complexed with gol, so4 |
PDB Entry: 4i6r (more details), 1.38 Å
SCOPe Domain Sequences for d4i6rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i6rb_ a.35.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkglev
sdvvffemlikeilkhd
Timeline for d4i6rb_: