Lineage for d1adwa_ (1adw A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. Protein Pseudoazurin [49522] (4 species)
  7. Species Thiosphaera pantotropha [TaxId:82367] [49526] (5 PDB entries)
  8. Domain d1adwa_: 1adw A: [22893]
    complexed with cu

Details for d1adwa_

PDB Entry: 1adw (more details), 2.5 Å

PDB Description: pseudoazurin
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d1adwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]}
athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
qvn

SCOPe Domain Coordinates for d1adwa_ are not available.

Timeline for d1adwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1adwb_