SCOPe 2.07: Domain d4hp5a2: 4hp5 A:521-600

Lineage for d4hp5a2 (4hp5 A:521-600)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Erwinia rhapontici [TaxId:55212] [228313] (5 PDB entries)

8. Domain d4hp5a2: 4hp5 A:521-600 [228929]
   Other proteins in same PDB: d4hp5a1
   automated match to d3gbda2
   complexed with ca, glc, gol; mutant

Details for d4hp5a2

PDB Entry: 4hp5, 2 Å

PDB Description: the crystal structure of isomaltulose synthase mutant e295a from erwinia rhapontici nx5 in complex with d-glucose

PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d4hp5a2:

Sequence; same for both SEQRES and ATOM records:

>d4hp5a2 b.71.1.0 (A:521-600) automated matches {Erwinia rhapontici [TaxId: 55212]}
gsyidldpdnnsvyaytrtlgaekylvvinfkeevmhytlpgdlsinkvitennshtivn
kndrqlrlepwqsgiyklnp

Timeline for d4hp5a2:

• d4hp5a2 first appeared in SCOPe 2.03
  
• d4hp5a2 appears in SCOPe 2.06
  
• d4hp5a2 appears in the current release, SCOPe 2.08